PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco018846.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family NAC
Protein Properties Length: 722aa    MW: 80106.1 Da    PI: 5.3729
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco018846.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.1e-5261331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtd+elv +yLk+kv+g k+el +vi+ vd+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat sgyWkatgkd+++++ +
  Aco018846.1   6 LPPGFRFHPTDDELVGYYLKRKVDGVKIEL-DVIPVVDLYKFEPWELPdKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATVSGYWKATGKDRKIVC-E 101
                  79****************************.99**************96434445667**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   +  g++ktLvfy+grap ge+tdW+mheyrl
  Aco018846.1 102 LSIYGIRKTLVFYQGRAPGGERTDWIMHEYRL 133
                  999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-593156IPR003441NAC domain
PROSITE profilePS5100556.7586156IPR003441NAC domain
PfamPF023654.8E-287133IPR003441NAC domain
SuperFamilySSF484529.96E-6340499IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513758.879367401IPR002885Pentatricopeptide repeat
PfamPF015350.0037372397IPR002885Pentatricopeptide repeat
PfamPF015351.7E-4401427IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.5E-4401435IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.256435469IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.41470500IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007560.0024475503IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.879501531IPR002885Pentatricopeptide repeat
PfamPF130414.9E-8501549IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007565.5E-4503538IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.697537571IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.848572602IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.6E-4577605IPR002885Pentatricopeptide repeat
PfamPF130416.9E-9602642IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.597603637IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007566.0E-7605638IPR002885Pentatricopeptide repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MTSMTLPPGF RFHPTDDELV GYYLKRKVDG VKIELDVIPV VDLYKFEPWE LPDKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATVSGYWK ATGKDRKIVC ELSIYGIRKT LVFYQGRAPG  120
GERTDWIMHE YRLCEDFSHG TSNFVGGFAL CRVVKRNDNG LKTSDLESKA KRGPSPILGL  180
SLEGCCSKAS KIPEEHSSLA STVSTPINSP EDIRRDVEFN PVLIDSDHQI QHALKSAQCS  240
EAVYQSATTP WLPSSAESNS PCSPSHLSSI NFAGDDFLIN DFHGDECLSF LPSLEELSDH  300
SFEFDMLKYP NTSLSGAETW NQLVPPTICR QESAGEEANL WLVLTPWPSM RGGPLHGQVL  360
KLGLDSDLYT ETTLISMYAA CGDVGGARKV FDKMDQRKNR VVWTSMVSWY TMNGYPKDAL  420
LLFAEMELEE GMEGDEVAIA SALSACAELK DLEYGKKLHC RIRQSGMKIC VVLGTALINL  480
YAKCGEMESA REVFDETPER NIVAWSAVIS GYAQNNQGKE ALKEFKKMVS DSDHKPNAIT  540
VMAVLSACAQ EGDLALGKWV HVNVEREGLN HSTGLKNSLI DMCSKCRKID VACEIFEGMK  600
EKDIVSWNAM INGLALHGLG DKALIYFSLM QKDGIKPDDI TFIGSWAVGR SGEVHPGDAH  660
EAGWSSMGWG ALLSGSNAYG NVELGEKAAK ELLDIEPNND SVYDFMCFCR TSMLRRSTGK  720
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-52116212171NO APICAL MERISTEM PROTEIN
1ut4_B3e-52116212171NO APICAL MERISTEM PROTEIN
1ut7_A3e-52116212171NO APICAL MERISTEM PROTEIN
1ut7_B3e-52116212171NO APICAL MERISTEM PROTEIN
3swm_A5e-52116215174NAC domain-containing protein 19
3swm_B5e-52116215174NAC domain-containing protein 19
3swm_C5e-52116215174NAC domain-containing protein 19
3swm_D5e-52116215174NAC domain-containing protein 19
3swp_A5e-52116215174NAC domain-containing protein 19
3swp_B5e-52116215174NAC domain-containing protein 19
3swp_C5e-52116215174NAC domain-containing protein 19
3swp_D5e-52116215174NAC domain-containing protein 19
4dul_A3e-52116212171NAC domain-containing protein 19
4dul_B3e-52116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A0L4G71e-112A0A0A0L4G7_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-82NAC domain containing protein 71